VIP (human, mouse, rat) acetate salt,CAS: 40077-57-4
H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH₂ acetate salt
Product description
VIP, a 28-amino acid peptide belonging to the secretin-glucagon-CRF family, is widely distributed in the central and peripheral nervous systems. Acting both as a neurotransmitter and as a hormone, VIP is involved in a wide variety of biological activities, including vaso- and bronchodilation, smooth muscle relaxation, and stimulation of secretion. An injectable formulation of this peptide in combination with the adrenergic drug phentolamine is expected to provide a new and effective alternative for erectile dysfunction patients.
| Appearance | N/A |
|---|---|
| Molecular weight | N/A |
| Purity | >90% |
| Solubility | N/A |
| Cas | 40077-57-4 |
| Sequence | HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂ |
| Molecular Formula | Aviptadil, VIP, human, porcine, rat, ovine |
| Molecular Formula | C₁₄₇H₂₃₈N₄₄O₄₂S |
| Storage | -20℃, protected from light and moisture |
| Transportation | 4-25℃ temperature for up to 3 weeks |
| Stability | 1 year |
Document
Related Product

Items-$0.00

Email:
Tel.:
msds of VIP (human, mouse, rat) acetate salt
RuixiBiotechCo.Ltd /KamulinBiotechco.ltd
Add: Room 20F 2002, Meiyuan Building, Yanta District, Xi’ an City, Shaanxi Province 710061 China
Tel: 02988811435
Fax: (86-29)8881-1435
Email: sales@ruixibiotech.com
Web: http://www.ruixibiotech.com


